General Information

  • ID:  hor005637
  • Uniprot ID:  Q7T273
  • Protein name:  Hepcidin-2
  • Gene name:  hamp2
  • Organism:  Danio rerio (Zebrafish) (Brachydanio rerio)
  • Family:  Hepcidin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Danio (genus), Danioninae (subfamily), Danionidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001530 lipopolysaccharide binding; GO:0005179 hormone activity; GO:0042834 peptidoglycan binding; GO:0070891 lipoteichoic acid binding
  • GO BP:  GO:0006879 intracellular iron ion homeostasis; GO:0007165 signal transduction; GO:0009617 response to bacterium; GO:0042742 defense response to bacterium; GO:0050829 defense response to Gram-negative bacterium; GO:0050830 defense response to Gram-positive bacterium; GO:0060586 multicellular organismal-level iron ion homeostasis; GO:0071383 cellular response to steroid hormone stimulus; GO:0071393 cellular response to progesterone stimulus; GO:0140367 antibacterial innate immune response
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QSHLSLCRFCCKCCRNKGCGYCCKF
  • Length:  25
  • Propeptide:  MKLSNVFLAAVVILTCVCVFQITAVPFIQQVQDEHHVESEELQENQHLTEAEHRLTDPLVLFRTKRQSHLSLCRFCCKCCRNKGCGYCCKF
  • Signal peptide:  MKLSNVFLAAVVILTCVCVFQITA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages.Inhibiting the growth of the Gram-negative bacteria Escherichia coli and Vibrio anguillarum, and the Gram-positive bacteria Staphylococcus aureus and Bacillus subtilis with minimum inhibitory concentrations (MICs) of 18, 15, 13 and 9μM,
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-23; 10-13; 11-19; 14-22
  • Structure ID:  AF-V9QFG9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005637_AF2.pdbhor005637_ESM.pdb

Physical Information

Mass: 331979 Formula: C118H188N38O31S8
Absent amino acids: ADEIMPTVW Common amino acids: C
pI: 8.6 Basic residues: 6
Polar residues: 14 Hydrophobic residues: 4
Hydrophobicity: -5.6 Boman Index: -4235
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 31.2
Instability Index: 3479.2 Extinction Coefficient cystines: 1990
Absorbance 280nm: 82.92

Literature

  • PubMed ID:  15043943
  • Title:  Organization and expression analysis of the zebrafish hepcidin gene, an antimicrobial peptide gene conserved among vertebrates.
  • PubMed ID:  24787654
  • Title:   Characterization and bioactivity of hepcidin-2 in zebrafish: dependence of antibacterial activity upon disulfide bridges